Recombinant Full Length Human FZR1 Protein, C-Flag-tagged
Cat.No. : | FZR1-1049HFL |
Product Overview : | Recombinant Full Length Human FZR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable anaphase-promoting complex binding activity and ubiquitin ligase activator activity. Involved in anaphase-promoting complex-dependent catabolic process; mitotic G2 DNA damage checkpoint signaling; and positive regulation of protein metabolic process. Located in nuclear membrane and nucleoplasm. Colocalizes with anaphase-promoting complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFT RIRSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | FZR1 fizzy and cell division cycle 20 related 1 [ Homo sapiens (human) ] |
Official Symbol | FZR1 |
Synonyms | FZR; CDH1; FZR2; HCDH; HCDH1; CDC20C; DEE109 |
Gene ID | 51343 |
mRNA Refseq | NM_016263.4 |
Protein Refseq | NP_057347.2 |
MIM | 603619 |
UniProt ID | Q9UM11 |
◆ Recombinant Proteins | ||
FZR1-4601H | Recombinant Human FZR1 Protein, GST-tagged | +Inquiry |
FZR1-5093HF | Recombinant Full Length Human FZR1 Protein, GST-tagged | +Inquiry |
FZR1-1599R | Recombinant Rhesus Macaque FZR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FZR1-1049HFL | Recombinant Full Length Human FZR1 Protein, C-Flag-tagged | +Inquiry |
FZR1-1160H | Recombinant Human FZR1 Protein (1-493 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZR1-6087HCL | Recombinant Human FZR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZR1 Products
Required fields are marked with *
My Review for All FZR1 Products
Required fields are marked with *
0
Inquiry Basket