Recombinant Full Length Human GIT1 Protein, C-Flag-tagged
Cat.No. : | GIT1-1144HFL |
Product Overview : | Recombinant Full Length Human GIT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables gamma-tubulin binding activity. Involved in positive regulation of microtubule nucleation and regulation of cytokinesis. Located in several cellular components, including focal adhesion; microtubule cytoskeleton; and mitochondrion. Implicated in attention deficit hyperactivity disorder. Biomarker of Huntington's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 84.2 kDa |
AA Sequence : | MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASN GANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQLHSS VRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDVNGRTPIDYARQA GHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELA MDVYDEVDRRENDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSE AKRRQQGKSLSSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEH TPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGV SASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELES LDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRS SLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | GIT1 GIT ArfGAP 1 [ Homo sapiens (human) ] |
Official Symbol | GIT1 |
Synonyms | p95-APP1 |
Gene ID | 28964 |
mRNA Refseq | NM_014030.4 |
Protein Refseq | NP_054749.2 |
MIM | 608434 |
UniProt ID | Q9Y2X7 |
◆ Recombinant Proteins | ||
GIT1-2200R | Recombinant Rat GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIT1-3983H | Recombinant Human GIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GIT1-2544R | Recombinant Rat GIT1 Protein | +Inquiry |
GIT1-3568M | Recombinant Mouse GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIT1-301196H | Recombinant Human GIT1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GIT1-001H | Recombinant Human GIT1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIT1-5926HCL | Recombinant Human GIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT1 Products
Required fields are marked with *
My Review for All GIT1 Products
Required fields are marked with *
0
Inquiry Basket