Recombinant Human GIT1 protein, His-tagged
Cat.No. : | GIT1-2814H |
Product Overview : | Recombinant Human GIT1 protein(471-640 aa), fused to His tag, was expressed in E. coli. |
Availability | August 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 471-640 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GIT1 G protein-coupled receptor kinase interacting ArfGAP 1 [ Homo sapiens ] |
Official Symbol | GIT1 |
Synonyms | GIT1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein coupled receptor kinase interactor 1; ARF GTPase-activating protein GIT1; CAT1; CAT-1; ARF GAP GIT1; GRK-interacting protein 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-interactor 1; cool-associated and tyrosine-phosphorylated protein 1; |
Gene ID | 28964 |
mRNA Refseq | NM_001085454 |
Protein Refseq | NP_001078923 |
MIM | 608434 |
UniProt ID | Q9Y2X7 |
◆ Recombinant Proteins | ||
Git1-3215M | Recombinant Mouse Git1 Protein, Myc/DDK-tagged | +Inquiry |
GIT1-2544R | Recombinant Rat GIT1 Protein | +Inquiry |
GIT1-3983H | Recombinant Human GIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GIT1-5869C | Recombinant Chicken GIT1 | +Inquiry |
GIT1-3568M | Recombinant Mouse GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GIT1-001H | Recombinant Human GIT1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIT1-5926HCL | Recombinant Human GIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT1 Products
Required fields are marked with *
My Review for All GIT1 Products
Required fields are marked with *