Recombinant Full Length Human GLO1 Protein, C-Flag-tagged

• Cat.No.: GLO1-1412HFL
• Product Overview: Recombinant Full Length Human GLO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 20.6 kDa
• AA Sequence: MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSL YFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK
  RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Pyruvate metabolism
• Full Length: Full L.

Gene Information

• Gene Name: GLO1 glyoxalase I [ Homo sapiens (human) ]
• Official Symbol: GLO1
• Synonyms: GLYI; GLOD1; HEL-S-74
• Gene ID: 2739
• mRNA Refseq: NM_006708.3
• Protein Refseq: NP_006699.2
• MIM: 138750
• UniProt ID: Q04760