Recombinant Full Length Human GLO1 Protein, C-Flag-tagged

Cat.No. : GLO1-1412HFL
Product Overview : Recombinant Full Length Human GLO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.6 kDa
AA Sequence : MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSL YFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK
RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Pyruvate metabolism
Full Length : Full L.
Gene Name GLO1 glyoxalase I [ Homo sapiens (human) ]
Official Symbol GLO1
Synonyms GLYI; GLOD1; HEL-S-74
Gene ID 2739
mRNA Refseq NM_006708.3
Protein Refseq NP_006699.2
MIM 138750
UniProt ID Q04760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLO1 Products

Required fields are marked with *

My Review for All GLO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon