Recombinant Full Length Human GLO1 Protein, C-Flag-tagged
Cat.No. : | GLO1-1412HFL |
Product Overview : | Recombinant Full Length Human GLO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSL YFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACK RFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | GLO1 glyoxalase I [ Homo sapiens (human) ] |
Official Symbol | GLO1 |
Synonyms | GLYI; GLOD1; HEL-S-74 |
Gene ID | 2739 |
mRNA Refseq | NM_006708.3 |
Protein Refseq | NP_006699.2 |
MIM | 138750 |
UniProt ID | Q04760 |
◆ Recombinant Proteins | ||
GLO1-4020H | Recombinant Human GLO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Glo1-7146M | Active Recombinant Mouse Glo1 Protein, His-tagged | +Inquiry |
GLO1-12367Z | Recombinant Zebrafish GLO1 | +Inquiry |
GLO1-1412HFL | Recombinant Full Length Human GLO1 Protein, C-Flag-tagged | +Inquiry |
Glo1-872M | Recombinant Mouse GLO1 protein(Ala2-Ile184), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLO1-5899HCL | Recombinant Human GLO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLO1 Products
Required fields are marked with *
My Review for All GLO1 Products
Required fields are marked with *
0
Inquiry Basket