Recombinant Full Length Human GMFB Protein, C-Flag-tagged
| Cat.No. : | GMFB-1669HFL |
| Product Overview : | Recombinant Full Length Human GMFB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable Arp2/3 complex binding activity. Predicted to be involved in actin filament debranching and negative regulation of Arp2/3 complex-mediated actin nucleation. Predicted to act upstream of or within learning and locomotory behavior. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 16.5 kDa |
| AA Sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF FTNVNFCVSKVFMYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | GMFB glia maturation factor beta [ Homo sapiens (human) ] |
| Official Symbol | GMFB |
| Synonyms | GMF |
| Gene ID | 2764 |
| mRNA Refseq | NM_004124.3 |
| Protein Refseq | NP_004115.1 |
| MIM | 601713 |
| UniProt ID | P60983 |
| ◆ Recombinant Proteins | ||
| Gmfb-034G | Recombinant Rat Gmfb Protein (141 aa) | +Inquiry |
| GMFB-8565H | Recombinant Human GMFB protein | +Inquiry |
| GMFB-994H | Recombinant Human GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
| GMFB-12333Z | Recombinant Zebrafish GMFB | +Inquiry |
| GMFB-13333H | Recombinant Human GMFB, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
