Recombinant Full Length Human GMFB Protein, C-Flag-tagged
Cat.No. : | GMFB-1669HFL |
Product Overview : | Recombinant Full Length Human GMFB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable Arp2/3 complex binding activity. Predicted to be involved in actin filament debranching and negative regulation of Arp2/3 complex-mediated actin nucleation. Predicted to act upstream of or within learning and locomotory behavior. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.5 kDa |
AA Sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF FTNVNFCVSKVFMYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GMFB glia maturation factor beta [ Homo sapiens (human) ] |
Official Symbol | GMFB |
Synonyms | GMF |
Gene ID | 2764 |
mRNA Refseq | NM_004124.3 |
Protein Refseq | NP_004115.1 |
MIM | 601713 |
UniProt ID | P60983 |
◆ Recombinant Proteins | ||
GMFB-3247H | Recombinant Human GMFB Protein (Met1-His142), C-His tagged | +Inquiry |
GMFB-26568TH | Recombinant Human GMFB protein | +Inquiry |
GMFB-04H | Recombinant Human Glia Maturation Factor beta | +Inquiry |
GMFB-7001M | Recombinant Mouse GMFB Protein | +Inquiry |
GMFB-2240R | Recombinant Rat GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *