Recombinant Human GMFB protein
Cat.No. : | GMFB-26568TH |
Product Overview : | Recombinant Human GMFB protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 141 |
Description : | The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Molecular Mass : | Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids. |
AA Sequence : | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
Endotoxin : | Less than 1 EU/μg of rHuGMF-β as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | GMFB |
Official Symbol | GMFB |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
Gene ID | 2764 |
mRNA Refseq | NM_004124 |
Protein Refseq | NP_004115 |
MIM | 601713 |
UniProt ID | P60983 |
◆ Recombinant Proteins | ||
GMFB-3247H | Recombinant Human GMFB Protein (Met1-His142), C-His tagged | +Inquiry |
GMFB-26568TH | Recombinant Human GMFB protein | +Inquiry |
Gmfb-3246M | Recombinant Mouse Gmfb Protein, Myc/DDK-tagged | +Inquiry |
GMFB-2585R | Recombinant Rat GMFB Protein | +Inquiry |
GMFB-1669HFL | Recombinant Full Length Human GMFB Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
0
Inquiry Basket