| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
141 |
| Description : |
The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
| Molecular Mass : |
Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids. |
| AA Sequence : |
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Endotoxin : |
Less than 1 EU/μg of rHuGMF-β as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |