Recombinant Full Length Human GNG3 Protein

Cat.No. : GNG3-216HF
Product Overview : Recombinant full length Human G gamma3 with N terminal proprietary tag; Predicted MW 33.99 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 75 amino acids
Description : G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al.
Form : Liquid
Molecular Mass : 33.990kDa inclusive of tags
AA Sequence : MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
Official Symbol GNG3
Synonyms GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3
Gene ID 2785
mRNA Refseq NM_012202
Protein Refseq NP_036334
MIM 608941
UniProt ID P63215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG3 Products

Required fields are marked with *

My Review for All GNG3 Products

Required fields are marked with *

0
cart-icon