Recombinant Human GNG3 Protein, GST-tagged

Cat.No. : GNG3-5069H
Product Overview : Human GNG3 full-length ORF ( AAH15563, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al., 2004 [PubMed 15314181]).
Molecular Mass : 33.99 kDa
AA Sequence : MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ]
Official Symbol GNG3
Synonyms GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; NBP gamma-3; guanine nucleotide-binding protein gamma-3 subunit;
Gene ID 2785
mRNA Refseq NM_012202
Protein Refseq NP_036334
MIM 608941
UniProt ID P63215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG3 Products

Required fields are marked with *

My Review for All GNG3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon