Recombinant Human GNG3 Protein, GST-tagged
Cat.No. : | GNG3-5069H |
Product Overview : | Human GNG3 full-length ORF ( AAH15563, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al., 2004 [PubMed 15314181]). |
Molecular Mass : | 33.99 kDa |
AA Sequence : | MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG3 guanine nucleotide binding protein (G protein), gamma 3 [ Homo sapiens ] |
Official Symbol | GNG3 |
Synonyms | GNG3; guanine nucleotide binding protein (G protein), gamma 3; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3; guanine nucleotide binding protein gamma 3 subunit; NBP gamma 3; NBP gamma-3; guanine nucleotide-binding protein gamma-3 subunit; |
Gene ID | 2785 |
mRNA Refseq | NM_012202 |
Protein Refseq | NP_036334 |
MIM | 608941 |
UniProt ID | P63215 |
◆ Recombinant Proteins | ||
GNG3-28960TH | Recombinant Human GNG3 | +Inquiry |
GNG3-7037M | Recombinant Mouse GNG3 Protein | +Inquiry |
GNG3-1725R | Recombinant Rhesus Macaque GNG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG3-5069H | Recombinant Human GNG3 Protein, GST-tagged | +Inquiry |
GNG3-1905R | Recombinant Rhesus monkey GNG3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG3-5852HCL | Recombinant Human GNG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG3 Products
Required fields are marked with *
My Review for All GNG3 Products
Required fields are marked with *
0
Inquiry Basket