Recombinant Full Length Human GNGT2 Protein, GST-tagged
Cat.No. : | GNGT2-5394HF |
Product Overview : | Human GNGT2 full-length ORF ( AAH08663, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 69 amino acids |
Description : | Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene. [provided by RefSeq |
Molecular Mass : | 33.33 kDa |
AA Sequence : | MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNGT2 guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 [ Homo sapiens ] |
Official Symbol | GNGT2 |
Synonyms | GNGT2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; GNG9; G-gamma-9; g gamma-C; gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; guanine nucleotide binding protein gamma transducing activity polypeptide 2; GNG8; GNGT8; G-GAMMA-8; G-GAMMA-C; |
Gene ID | 2793 |
mRNA Refseq | NM_001198754 |
Protein Refseq | NP_001185683 |
MIM | 139391 |
UniProt ID | O14610 |
◆ Recombinant Proteins | ||
GNGT2-1503H | Recombinant Human GNGT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNGT2-1728R | Recombinant Rhesus Macaque GNGT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNGT2-13367H | Recombinant Human GNGT2 protein, GST-tagged | +Inquiry |
GNGT2-1908R | Recombinant Rhesus monkey GNGT2 Protein, His-tagged | +Inquiry |
Gngt2-1040M | Recombinant Mouse Gngt2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNGT2-5849HCL | Recombinant Human GNGT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNGT2 Products
Required fields are marked with *
My Review for All GNGT2 Products
Required fields are marked with *
0
Inquiry Basket