Recombinant Full Length Human GNPDA2 Protein, GST-tagged
Cat.No. : | GNPDA2-5403HF |
Product Overview : | Human GNPDA2 full-length ORF ( NP_612208.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 276 amino acids |
Description : | The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens ] |
Official Symbol | GNPDA2 |
Synonyms | GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2; |
Gene ID | 132789 |
mRNA Refseq | NM_138335 |
Protein Refseq | NP_612208 |
MIM | 613222 |
UniProt ID | Q8TDQ7 |
◆ Recombinant Proteins | ||
GNPDA2-0131H | Recombinant Human GNPDA2 Protein (R2-N276), His tagged | +Inquiry |
Gnpda2-3264M | Recombinant Mouse Gnpda2 Protein, Myc/DDK-tagged | +Inquiry |
GNPDA2-4679H | Recombinant Human GNPDA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNPDA2-1057HFL | Recombinant Full Length Human GNPDA2 Protein, C-Flag-tagged | +Inquiry |
GNPDA2-1733R | Recombinant Rhesus Macaque GNPDA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA2-5842HCL | Recombinant Human GNPDA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNPDA2 Products
Required fields are marked with *
My Review for All GNPDA2 Products
Required fields are marked with *
0
Inquiry Basket