Recombinant Full Length Human GNPDA2 Protein, GST-tagged

Cat.No. : GNPDA2-5403HF
Product Overview : Human GNPDA2 full-length ORF ( NP_612208.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 276 amino acids
Description : The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
Molecular Mass : 57.5 kDa
AA Sequence : MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNPDA2 glucosamine-6-phosphate deaminase 2 [ Homo sapiens ]
Official Symbol GNPDA2
Synonyms GNPDA2; glucosamine-6-phosphate deaminase 2; glucosamine-6-phosphate isomerase 2; glucosamine 6 phosphate isomerase; SB52; GNPDA 2; 4921523I18Rik; glcN6P deaminase 2; glucosamine-6-phosphate isomerase SB52; putative glucosamine-6-phosphate isomerase; GNP2;
Gene ID 132789
mRNA Refseq NM_138335
Protein Refseq NP_612208
MIM 613222
UniProt ID Q8TDQ7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNPDA2 Products

Required fields are marked with *

My Review for All GNPDA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon