Recombinant Full Length Human GPR55 Protein

• Cat.No.: GPR55-5600HF
• Product Overview: Human GPR55 full-length ORF (NP_005674.2) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 675 amino acids
• Description: Members of the G protein-coupled receptor (GPR) family, such as GPR55, play important roles in signal transduction from the external environment to the inside of the cell (Sawzdargo et al., 1999 [PubMed 9931487]).[supplied by OMIM
• Form: Liquid
• Molecular Mass: 36.6 kDa
• AA Sequence: MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR55 G protein-coupled receptor 55 [ Homo sapiens ]
• Official Symbol: GPR55
• Synonyms: GPR55; G protein-coupled receptor 55; G-protein coupled receptor 55
• Gene ID: 9290
• mRNA Refseq: NM_005683
• Protein Refseq: NP_005674
• MIM: 604107
• UniProt ID: Q9Y2T6