Recombinant Human GPR55 Protein
Cat.No. : | GPR55-5252H |
Product Overview : | Human GPR55 full-length ORF (NP_005674.2) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | Members of the G protein-coupled receptor (GPR) family, such as GPR55, play important roles in signal transduction from the external environment to the inside of the cell (Sawzdargo et al., 1999 [PubMed 9931487]).[supplied by OMIM |
Form : | Liquid |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GPR55 G protein-coupled receptor 55 [ Homo sapiens ] |
Official Symbol | GPR55 |
Synonyms | GPR55; G protein-coupled receptor 55; G-protein coupled receptor 55; |
Gene ID | 9290 |
mRNA Refseq | NM_005683 |
Protein Refseq | NP_005674 |
MIM | 604107 |
UniProt ID | Q9Y2T6 |
◆ Recombinant Proteins | ||
GPR55-5252H | Recombinant Human GPR55 Protein | +Inquiry |
RFL24539MF | Recombinant Full Length Mouse G-Protein Coupled Receptor 55(Gpr55) Protein, His-Tagged | +Inquiry |
GPR55-5600HF | Recombinant Full Length Human GPR55 Protein | +Inquiry |
GPR55-957H | Recombinant Human GPR55 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR55-5783HCL | Recombinant Human GPR55 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR55 Products
Required fields are marked with *
My Review for All GPR55 Products
Required fields are marked with *