Recombinant Full Length Human growth hormone secretagogue receptor Protein, Tag Free, Liposome

Cat.No. : GHSR-06HFL
Product Overview : Human GHSR full-length ORF (NP_004113.1) recombinant protein without tag. This product is belong to Proteoliposome (PL).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 1-366aa
Description : This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a.
Tag : Non
Form : Liquid
Molecular Mass : 32.2 kDa
AA Sequence : MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Applications : Antibody Production
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name GHSR growth hormone secretagogue receptor [ Homo sapiens (human) ]
Official Symbol GHSR
Synonyms GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1; GHRP; GHS-R; ghrelin receptor; GH-releasing peptide receptor;
Gene ID 2693
mRNA Refseq NM_004122
Protein Refseq NP_004113
MIM 601898
UniProt ID Q92847

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GHSR Products

Required fields are marked with *

My Review for All GHSR Products

Required fields are marked with *

0
cart-icon