Recombinant Full Length Human GSTO1 Protein, C-Flag-tagged
Cat.No. : | GSTO1-1351HFL |
Product Overview : | Recombinant Full Length Human GSTO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP TVSALLTSEKDWQGFLELYLQNSPEACDYGLSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Full Length : | Full L. |
Gene Name | GSTO1 glutathione S-transferase omega 1 [ Homo sapiens (human) ] |
Official Symbol | GSTO1 |
Synonyms | P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21 |
Gene ID | 9446 |
mRNA Refseq | NM_004832.3 |
Protein Refseq | NP_004823.1 |
MIM | 605482 |
UniProt ID | P78417 |
◆ Recombinant Proteins | ||
GSTO1-30H | Recombinant Human GSTO1 protein(Gly3~Gly240), His-tagged | +Inquiry |
GSTO1-579C | Recombinant Cynomolgus GSTO1 Protein, His-tagged | +Inquiry |
GSTO1-4789C | Recombinant Chicken GSTO1 | +Inquiry |
GSTO1-498H | Recombinant Human Glutathione S-transferase Omega 1 | +Inquiry |
GSTO1-1816R | Recombinant Rhesus Macaque GSTO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO1-761HCL | Recombinant Human GSTO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTO1 Products
Required fields are marked with *
My Review for All GSTO1 Products
Required fields are marked with *
0
Inquiry Basket