Recombinant Full Length Human GTF2H3 Protein, GST-tagged

Cat.No. : GTF2H3-3388HF
Product Overview : Human GTF2H3 full-length ORF ( NP_001507.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 308 amino acids
Description : This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. [provided by RefSeq, Dec 2012]
Molecular Mass : 60.8 kDa
AA Sequence : MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF2H3 general transcription factor IIH, polypeptide 3, 34kDa [ Homo sapiens ]
Official Symbol GTF2H3
Synonyms GTF2H3; general transcription factor IIH, polypeptide 3, 34kDa; general transcription factor IIH, polypeptide 3 (34kD subunit); general transcription factor IIH subunit 3; BTF2; TFIIH; BTF2 p34; basic transcription factor 2 34 kDa subunit; general transcription factor IIH polypeptide 3; TFIIH basal transcription factor complex p34 subunit; TFB4;
Gene ID 2967
mRNA Refseq NM_001516
Protein Refseq NP_001507
MIM 601750
UniProt ID Q13889

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2H3 Products

Required fields are marked with *

My Review for All GTF2H3 Products

Required fields are marked with *

0
cart-icon