Recombinant Human GTF2H3 Protein, GST-tagged
Cat.No. : | GTF2H3-4450H |
Product Overview : | Human GTF2H3 full-length ORF ( NP_001507.2, 1 a.a. - 308 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. [provided by RefSeq, Dec 2012] |
Molecular Mass : | 60.8 kDa |
AA Sequence : | MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTF2H3 general transcription factor IIH, polypeptide 3, 34kDa [ Homo sapiens ] |
Official Symbol | GTF2H3 |
Synonyms | GTF2H3; general transcription factor IIH, polypeptide 3, 34kDa; general transcription factor IIH, polypeptide 3 (34kD subunit); general transcription factor IIH subunit 3; BTF2; TFIIH; BTF2 p34; basic transcription factor 2 34 kDa subunit; general transcription factor IIH polypeptide 3; TFIIH basal transcription factor complex p34 subunit; TFB4; |
Gene ID | 2967 |
mRNA Refseq | NM_001516 |
Protein Refseq | NP_001507 |
MIM | 601750 |
UniProt ID | Q13889 |
◆ Recombinant Proteins | ||
GTF2H3-13598H | Recombinant Human GTF2H3 protein, His-tagged | +Inquiry |
GTF2H3-4450H | Recombinant Human GTF2H3 Protein, GST-tagged | +Inquiry |
GTF2H3-2744R | Recombinant Rat GTF2H3 Protein | +Inquiry |
GTF2H3-685Z | Recombinant Zebrafish GTF2H3 | +Inquiry |
GTF2H3-4910C | Recombinant Chicken GTF2H3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2H3-5695HCL | Recombinant Human GTF2H3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2H3 Products
Required fields are marked with *
My Review for All GTF2H3 Products
Required fields are marked with *
0
Inquiry Basket