Recombinant Full Length Human GZMM Protein, GST-tagged
Cat.No. : | GZMM-3394HF |
Product Overview : | Human GZMM full-length ORF ( AAH25701.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: granzyme A, granzyme B, granzyme H, and Met-ase, also known as granzyme M. [provided by RefSeq |
Molecular Mass : | 54.01 kDa |
AA Sequence : | MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ] |
Official Symbol | GZMM |
Synonyms | GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease; |
Gene ID | 3004 |
mRNA Refseq | NM_005317 |
Protein Refseq | NP_005308 |
MIM | 600311 |
UniProt ID | P51124 |
◆ Recombinant Proteins | ||
GZMM-3350H | Recombinant Human GZMM Protein (Ile26-Ala257), His tagged | +Inquiry |
GZMM-97H | Recombinant Human GZMM, His-tagged | +Inquiry |
Gzmm-651M | Recombinant Mouse Gzmm Protein, His/GST-tagged | +Inquiry |
GZMM-98H | Active Recombinant Human GZMM protein, His-tagged | +Inquiry |
GZMM-3394HF | Recombinant Full Length Human GZMM Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMM-5666HCL | Recombinant Human GZMM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMM Products
Required fields are marked with *
My Review for All GZMM Products
Required fields are marked with *