Recombinant Full Length Human HAT1 Protein, GST-tagged
Cat.No. : | HAT1-3485HF |
Product Overview : | Human HAT1 full-length ORF ( AAH63003, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 334 amino acids |
Description : | The protein encoded by this gene is a type B histone acetyltransferase (HAT) that is involved in the rapid acetylation of newly synthesized cytoplasmic histones, which are in turn imported into the nucleus for de novo deposition onto nascent DNA chains. Histone acetylation, particularly of histone H4, plays an important role in replication-dependent chromatin assembly. Specifically, this HAT can acetylate soluble but not nucleosomal histone H4 at lysines 5 and 12, and to a lesser degree, histone H2A at lysine 5. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 62.48 kDa |
AA Sequence : | MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAT1 histone acetyltransferase 1 [ Homo sapiens ] |
Official Symbol | HAT1 |
Synonyms | HAT1; histone acetyltransferase 1; histone acetyltransferase type B catalytic subunit; KAT1; |
Gene ID | 8520 |
mRNA Refseq | NM_003642 |
Protein Refseq | NP_003633 |
MIM | 603053 |
UniProt ID | O14929 |
◆ Recombinant Proteins | ||
HAT1-2793R | Recombinant Rat HAT1 Protein | +Inquiry |
HAT1-5781C | Recombinant Chicken HAT1 | +Inquiry |
Hat1-2007M | Recombinant Mouse Hat1 protein, His & T7-tagged | +Inquiry |
HAT1-4586H | Recombinant Human HAT1 Protein, GST-tagged | +Inquiry |
HAT1-569H | Recombinant Human Histone Acetyltransferase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAT1-5631HCL | Recombinant Human HAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAT1 Products
Required fields are marked with *
My Review for All HAT1 Products
Required fields are marked with *