Recombinant Human HECTD2 protein, His-tagged

Cat.No. : HECTD2-20H
Product Overview : Recombinant Human HECTD2 protein(428-776 aa) was expressed in E. coli with a polyhistidine tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 428-776 a.a.
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHWFSSFKCDNYSEFRLVGILMGLAVYNSITFDIRFPPCCYKKLLSPPIIPSGQNIPVGICNVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKISVTNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNETSTNCLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEGFGLE
Gene Name HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ]
Official Symbol HECTD2
Synonyms HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050;
Gene ID 143279
mRNA Refseq NM_173497
Protein Refseq NP_775768
UniProt ID Q5U5R9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HECTD2 Products

Required fields are marked with *

My Review for All HECTD2 Products

Required fields are marked with *

0
cart-icon