Recombinant Full Length Human HFE Protein, C-Flag-tagged
Cat.No. : | HFE-455HFL |
Product Overview : | Recombinant Full Length Human HFE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEP RTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGY DGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLV KVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRY TCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | HFE homeostatic iron regulator [ Homo sapiens (human) ] |
Official Symbol | HFE |
Synonyms | HH; HFE1; HLA-H; MVCD7; TFQTL2 |
Gene ID | 3077 |
mRNA Refseq | NM_000410.4 |
Protein Refseq | NP_000401.1 |
MIM | 613609 |
UniProt ID | Q30201 |
◆ Recombinant Proteins | ||
RFL32292MF | Recombinant Full Length Mouse Hereditary Hemochromatosis Protein Homolog(Hfe) Protein, His-Tagged | +Inquiry |
HFE-4467H | Recombinant Human HFE protein, His&Myc-tagged | +Inquiry |
HFE-4144M | Recombinant Mouse HFE Protein, His (Fc)-Avi-tagged | +Inquiry |
HFE-4721H | Recombinant Human HFE Protein, GST-tagged | +Inquiry |
HFE-1065H | Recombinant Human HFE Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HFE-5572HCL | Recombinant Human HFE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HFE Products
Required fields are marked with *
My Review for All HFE Products
Required fields are marked with *
0
Inquiry Basket