Recombinant Full Length Human HLA-DQB2 Protein, GST-tagged

Cat.No. : HLA-DQB2-3599HF
Product Overview : Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 231 amino acids
Description : HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. [provided by RefSeq, Oct 2010]
Molecular Mass : 51.15 kDa
AA Sequence : MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HLA-DQB2 major histocompatibility complex, class II, DQ beta 2 [ Homo sapiens ]
Official Symbol HLA-DQB2
Synonyms HLA-DQB2; major histocompatibility complex, class II, DQ beta 2; HLA DXB; HLA class II histocompatibility antigen, DQ beta 2 chain; MHC class II antigen DQB2; major histocompatibility complex, class II, DQ beta 1; HLA class II histocompatibility antigen, DX beta chain; DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)); HLA-DXB; HLA-DQB1;
Gene ID 3120
mRNA Refseq NM_001198858
Protein Refseq NP_001185787
MIM 615161
UniProt ID P05538

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DQB2 Products

Required fields are marked with *

My Review for All HLA-DQB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon