Recombinant Human HLA-DQB2 Protein, GST-tagged
| Cat.No. : | HLA-DQB2-4846H |
| Product Overview : | Human HLA-DQB2 full-length ORF ( AAH31995, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-231 a.a. |
| Description : | HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. Because there is evidence of transcription and an intact ORF, HLA-DQB2 is represented in Entrez Gene and in RefSeq as a protein-coding locus. [provided by RefSeq, Oct 2010] |
| Molecular Mass : | 51.15 kDa |
| AA Sequence : | MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HLA-DQB2 major histocompatibility complex, class II, DQ beta 2 [ Homo sapiens ] |
| Official Symbol | HLA-DQB2 |
| Synonyms | HLA-DQB2; major histocompatibility complex, class II, DQ beta 2; HLA DXB; HLA class II histocompatibility antigen, DQ beta 2 chain; MHC class II antigen DQB2; major histocompatibility complex, class II, DQ beta 1; HLA class II histocompatibility antigen, DX beta chain; DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)); HLA-DXB; HLA-DQB1; |
| Gene ID | 3120 |
| mRNA Refseq | NM_001198858 |
| Protein Refseq | NP_001185787 |
| UniProt ID | P05538 |
| ◆ Recombinant Proteins | ||
| HLA-DQB2-3599HF | Recombinant Full Length Human HLA-DQB2 Protein, GST-tagged | +Inquiry |
| HLA-DQB2-313H | Recombinant Human HLA-DQB2 Protein, MYC/DDK-tagged | +Inquiry |
| HLA-DQB2-4846H | Recombinant Human HLA-DQB2 Protein, GST-tagged | +Inquiry |
| HLA-DQB2-4750H | Recombinant Human HLA-DQB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-DQB2-796HCL | Recombinant Human HLA-DQB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DQB2 Products
Required fields are marked with *
My Review for All HLA-DQB2 Products
Required fields are marked with *
