Recombinant Full Length Human HSPB8 Protein, GST-tagged
Cat.No. : | HSPB8-3969HF |
Product Overview : | Human HSPB8 full-length ORF ( AAH02673.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 196 amino acids |
Description : | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq |
Molecular Mass : | 47.30 kDa |
AA Sequence : | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPB8 heat shock 22kDa protein 8 [ Homo sapiens ] |
Official Symbol | HSPB8 |
Synonyms | HSPB8; heat shock 22kDa protein 8; heat shock 27kDa protein 8; heat shock protein beta-8; E2IG1; H11; HSP22; HspB8; protein kinase H11; alpha-crystallin C chain; E2-induced gene 1 protein; small stress protein-like protein HSP22; HMN2; CMT2L; DHMN2; HMN2A; |
Gene ID | 26353 |
mRNA Refseq | NM_014365 |
Protein Refseq | NP_055180 |
MIM | 608014 |
UniProt ID | Q9UJY1 |
◆ Recombinant Proteins | ||
HSPB8-4366M | Recombinant Mouse HSPB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB8-6700H | Recombinant Human HSPB8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPB8-5120H | Recombinant Human HSPB8 Protein, GST-tagged | +Inquiry |
HSPB8-165H | Recombinant Human HSPB8 protein, His/MBP-tagged | +Inquiry |
HSPB8-2954R | Recombinant Rat HSPB8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB8-5345HCL | Recombinant Human HSPB8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPB8 Products
Required fields are marked with *
My Review for All HSPB8 Products
Required fields are marked with *
0
Inquiry Basket