Recombinant Full Length Human HTN3 Protein, GST-tagged
Cat.No. : | HTN3-5671HF |
Product Overview : | Human HTN3 full-length ORF ( AAH09791, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 51 amino acids |
Description : | This gene encodes a member of the histatin family of small, histidine-rich salivary proteins. Histatins exhibit non-immunological, anti-microbial activity in the oral cavity. [provided by RefSeq |
Molecular Mass : | 31.35 kDa |
AA Sequence : | MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTN3 histatin 3 [ Homo sapiens ] |
Official Symbol | HTN3 |
Synonyms | HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5; |
Gene ID | 3347 |
mRNA Refseq | NM_000200 |
Protein Refseq | NP_000191 |
MIM | 142702 |
UniProt ID | P15516 |
◆ Recombinant Proteins | ||
HTN3-5252H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
HTN3-1641H | Recombinant Human HTN3 Protein, His&GST-tagged | +Inquiry |
HTN3-2363H | Recombinant Human HTN3 Protein (Asp20-Asn51) | +Inquiry |
HTN3-5671HF | Recombinant Full Length Human HTN3 Protein, GST-tagged | +Inquiry |
HTN3-203H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTN3 Products
Required fields are marked with *
My Review for All HTN3 Products
Required fields are marked with *
0
Inquiry Basket