Recombinant Human HTN3 Protein, GST-tagged

Cat.No. : HTN3-5252H
Product Overview : Human HTN3 full-length ORF ( AAH09791, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the histatin family of small, histidine-rich salivary proteins. Histatins exhibit non-immunological, anti-microbial activity in the oral cavity. [provided by RefSeq
Molecular Mass : 31.35 kDa
AA Sequence : MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HTN3 histatin 3 [ Homo sapiens ]
Official Symbol HTN3
Synonyms HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5;
Gene ID 3347
mRNA Refseq NM_000200
Protein Refseq NP_000191
MIM 142702
UniProt ID P15516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTN3 Products

Required fields are marked with *

My Review for All HTN3 Products

Required fields are marked with *

0
cart-icon