Recombinant Human HTN3 Protein, GST-tagged
| Cat.No. : | HTN3-5252H |
| Product Overview : | Human HTN3 full-length ORF ( AAH09791, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the histatin family of small, histidine-rich salivary proteins. Histatins exhibit non-immunological, anti-microbial activity in the oral cavity. [provided by RefSeq |
| Molecular Mass : | 31.35 kDa |
| AA Sequence : | MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HTN3 histatin 3 [ Homo sapiens ] |
| Official Symbol | HTN3 |
| Synonyms | HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5; |
| Gene ID | 3347 |
| mRNA Refseq | NM_000200 |
| Protein Refseq | NP_000191 |
| MIM | 142702 |
| UniProt ID | P15516 |
| ◆ Recombinant Proteins | ||
| HTN3-5671HF | Recombinant Full Length Human HTN3 Protein, GST-tagged | +Inquiry |
| HTN3-5252H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
| HTN3-1641H | Recombinant Human HTN3 Protein, His&GST-tagged | +Inquiry |
| HTN3-2363H | Recombinant Human HTN3 Protein (Asp20-Asn51) | +Inquiry |
| HTN3-203H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTN3 Products
Required fields are marked with *
My Review for All HTN3 Products
Required fields are marked with *
