Recombinant Human HTN3 Protein, GST-tagged
Cat.No. : | HTN3-203H |
Product Overview : | Recombinant Human HTN3 fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 8.5 |
Molecular Mass : | 31.4kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFHEKHHS |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | HTN3 histatin 3 [ Homo sapiens ] |
Official Symbol | HTN3 |
Synonyms | HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5; |
Gene ID | 3347 |
mRNA Refseq | NM_000200 |
Protein Refseq | NP_000191 |
MIM | 142702 |
UniProt ID | P15516 |
◆ Recombinant Proteins | ||
HTN3-1641H | Recombinant Human HTN3 Protein, His&GST-tagged | +Inquiry |
HTN3-5671HF | Recombinant Full Length Human HTN3 Protein, GST-tagged | +Inquiry |
HTN3-2363H | Recombinant Human HTN3 Protein (Asp20-Asn51) | +Inquiry |
HTN3-203H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
HTN3-5252H | Recombinant Human HTN3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTN3 Products
Required fields are marked with *
My Review for All HTN3 Products
Required fields are marked with *