Recombinant Human HTN3 Protein, GST-tagged

Cat.No. : HTN3-203H
Product Overview : Recombinant Human HTN3 fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 8.5
Molecular Mass : 31.4kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFHEKHHS
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name HTN3 histatin 3 [ Homo sapiens ]
Official Symbol HTN3
Synonyms HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5;
Gene ID 3347
mRNA Refseq NM_000200
Protein Refseq NP_000191
MIM 142702
UniProt ID P15516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTN3 Products

Required fields are marked with *

My Review for All HTN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon