Recombinant Full Length Human HTR5A Protein
Cat.No. : | HTR5A-242HF |
Product Overview : | Recombinant full length Human 5HT5A receptor (aa 1-357) with N terminal proprietary tag, 65.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 357 amino acids |
Description : | The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. |
Form : | Liquid |
Molecular Mass : | 65.340kDa inclusive of tags |
AA Sequence : | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFG VLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVA SMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNV MIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWK SIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | HTR5A 5-hydroxytryptamine (serotonin) receptor 5A [ Homo sapiens ] |
Official Symbol | HTR5A |
Synonyms | HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A |
Gene ID | 3361 |
mRNA Refseq | NM_024012 |
Protein Refseq | NP_076917 |
MIM | 601305 |
UniProt ID | P47898 |
◆ Recombinant Proteins | ||
HTR5A-2194H | Recombinant Human HTR5A Protein, MYC/DDK-tagged | +Inquiry |
HTR5A-1997R | Recombinant Rhesus Macaque HTR5A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32294HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 5A(Htr5A) Protein, His-Tagged | +Inquiry |
HTR5A-7938M | Recombinant Mouse HTR5A Protein | +Inquiry |
HTR5A-2295H | Recombinant Human HTR5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR5A Products
Required fields are marked with *
My Review for All HTR5A Products
Required fields are marked with *
0
Inquiry Basket