Recombinant Full Length Human HTR5A Protein
Cat.No. : | HTR5A-242HF |
Product Overview : | Recombinant full length Human 5HT5A receptor (aa 1-357) with N terminal proprietary tag, 65.34 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 65.340kDa inclusive of tags |
Protein Length : | 357 amino acids |
AA Sequence : | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFG VLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVA SMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNV MIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSY AVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWK SIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HTR5A 5-hydroxytryptamine (serotonin) receptor 5A [ Homo sapiens ] |
Official Symbol : | HTR5A |
Synonyms : | HTR5A; 5-hydroxytryptamine (serotonin) receptor 5A; 5-hydroxytryptamine receptor 5A; 5 HT5A |
Gene ID : | 3361 |
mRNA Refseq : | NM_024012 |
Protein Refseq : | NP_076917 |
MIM : | 601305 |
UniProt ID : | P47898 |
Products Types
◆ Recombinant Protein | ||
Htr5a-1196M | Recombinant Mouse Htr5a Protein, MYC/DDK-tagged | +Inquiry |
HTR5A-2623R | Recombinant Rat HTR5A Protein, His (Fc)-Avi-tagged | +Inquiry |
HTR5A-1997R | Recombinant Rhesus Macaque HTR5A Protein, His (Fc)-Avi-tagged | +Inquiry |
HTR5A-5235H | Recombinant Human HTR5A Protein, GST-tagged | +Inquiry |
HTR5A-2194H | Recombinant Human HTR5A Protein, MYC/DDK-tagged | +Inquiry |
◆ Assay kits | ||
Kit-1358 | HTR5A U2OS β-Arrestin GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket