Recombinant Full Length Human IFITM5 Protein, C-Flag-tagged
Cat.No. : | IFITM5-1853HFL |
Product Overview : | Recombinant Full Length Human IFITM5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVG DLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | IFITM5 interferon induced transmembrane protein 5 [ Homo sapiens (human) ] |
Official Symbol | IFITM5 |
Synonyms | OI5; BRIL; DSPA1; Hrmp1; fragilis4 |
Gene ID | 387733 |
mRNA Refseq | NM_001025295.3 |
Protein Refseq | NP_001020466.1 |
MIM | 614757 |
UniProt ID | A6NNB3 |
◆ Recombinant Proteins | ||
Ifitm5-3481M | Recombinant Mouse Ifitm5 Protein, Myc/DDK-tagged | +Inquiry |
RFL15549MF | Recombinant Full Length Mouse Interferon-Induced Transmembrane Protein 5(Ifitm5) Protein, His-Tagged | +Inquiry |
IFITM5-7713Z | Recombinant Zebrafish IFITM5 | +Inquiry |
IFITM5-1853HFL | Recombinant Full Length Human IFITM5 Protein, C-Flag-tagged | +Inquiry |
RFL12357HF | Recombinant Full Length Human Interferon-Induced Transmembrane Protein 5(Ifitm5) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFITM5 Products
Required fields are marked with *
My Review for All IFITM5 Products
Required fields are marked with *
0
Inquiry Basket