Recombinant Full Length Human IKBKB Protein
| Cat.No. : | IKBKB-255HF |
| Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 256 amino acids |
| Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 53.790kDa inclusive of tags |
| AA Sequence : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
| Official Symbol | IKBKB |
| Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB |
| Gene ID | 3551 |
| mRNA Refseq | NM_001190720 |
| Protein Refseq | NP_001177649 |
| MIM | 603258 |
| UniProt ID | O14920 |
| ◆ Recombinant Proteins | ||
| IKBKB-79HFL | Active Recombinant Full Length Human IKBKB Protein, N-His-tagged | +Inquiry |
| IKBKB-1162H | Recombinant Human IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
| IKBKB-88H | Active Recombinant Human IKKB-beta | +Inquiry |
| IKBKB-1064H | Recombinant Human IKBKB Protein (S695-S756), Tag Free | +Inquiry |
| IKBKB-1720H | Recombinant Human IKBKB protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
