Recombinant Full Length Human IKBKB Protein
Cat.No. : | IKBKB-255HF |
Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 256 amino acids |
Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 53.790kDa inclusive of tags |
AA Sequence : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
Official Symbol | IKBKB |
Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB |
Gene ID | 3551 |
mRNA Refseq | NM_001190720 |
Protein Refseq | NP_001177649 |
MIM | 603258 |
UniProt ID | O14920 |
◆ Recombinant Proteins | ||
IKBKB-1720H | Recombinant Human IKBKB protein, His & GST-tagged | +Inquiry |
IKBKB-14132H | Recombinant Human IKBKB, GST-tagged | +Inquiry |
IKBKB-2232H | Recombinant Human IKBKB Full Length Protein, His-tagged | +Inquiry |
IKBKB-760H | Recombinant Human IKBKB, His-S | +Inquiry |
IKBKB-501H | Recombinant Human IKBKB Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
0
Inquiry Basket