Recombinant Human IKBKB
| Cat.No. : | IKBKB-28877TH |
| Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 256 amino acids |
| Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
| Molecular Weight : | 53.790kDa inclusive of tags |
| Tissue specificity : | Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
| Sequence Similarities : | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.Contains 1 protein kinase domain. |
| Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
| Official Symbol | IKBKB |
| Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB; |
| Gene ID | 3551 |
| mRNA Refseq | NM_001190720 |
| Protein Refseq | NP_001177649 |
| MIM | 603258 |
| Uniprot ID | O14920 |
| Chromosome Location | 8p11.2 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
| Function | ATP binding; IkappaB kinase activity; nucleotide binding; protein binding; protein kinase activity; |
| ◆ Recombinant Proteins | ||
| IKBKB-3048C | Recombinant Chicken IKBKB | +Inquiry |
| IKBKB-1162H | Recombinant Human IKBKB Protein, His (Fc)-Avi-tagged | +Inquiry |
| IKBKB-2232H | Recombinant Human IKBKB Full Length Protein, His-tagged | +Inquiry |
| IKBKB-28877TH | Recombinant Human IKBKB | +Inquiry |
| IKBKB-2225R | Recombinant Rhesus monkey IKBKB Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
