Recombinant Human IKBKB
Cat.No. : | IKBKB-28877TH |
Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 256 amino acids |
Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
Molecular Weight : | 53.790kDa inclusive of tags |
Tissue specificity : | Highly expressed in heart, placenta, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis and peripheral blood. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
Sequence Similarities : | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. I-kappa-B kinase subfamily.Contains 1 protein kinase domain. |
Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
Official Symbol | IKBKB |
Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB; |
Gene ID | 3551 |
mRNA Refseq | NM_001190720 |
Protein Refseq | NP_001177649 |
MIM | 603258 |
Uniprot ID | O14920 |
Chromosome Location | 8p11.2 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
Function | ATP binding; IkappaB kinase activity; nucleotide binding; protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
IKBKB-89H | Recombinant Human IKB-beta | +Inquiry |
IKBKB-1064H | Recombinant Human IKBKB Protein (S695-S756), Tag Free | +Inquiry |
IKBKB-255HF | Recombinant Full Length Human IKBKB Protein | +Inquiry |
IKBKB-760H | Recombinant Human IKBKB, His-S | +Inquiry |
Ikbkb-5691M | Recombinant Mouse Ikbkb Protein (Ser2-Asp757), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
0
Inquiry Basket