Recombinant Human IKBKB Full Length Protein, His-tagged
Cat.No. : | IKBKB-2232H |
Product Overview : | Recombinant Human HOMER2 protein(150-343 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 150-343 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HLKSENDKLKIALTQSAANVKKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN |
Gene Name | HOMER2 homer homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | HOMER2 |
Synonyms | HOMER2; homer homolog 2 (Drosophila); homer protein homolog 2; CPD; Cupidin; HOMER 2; HOMER 2A; HOMER 2B; Vesl 2; cupidin; homer homolog 3; homer, neuronal immediate early gene, 2; ACPD; VESL-2; HOMER-2; |
Gene ID | 9455 |
mRNA Refseq | NM_004839 |
Protein Refseq | NP_004830 |
MIM | 604799 |
UniProt ID | Q9NSB8 |
◆ Recombinant Proteins | ||
IKBKB-3048C | Recombinant Chicken IKBKB | +Inquiry |
IKBKB-255HF | Recombinant Full Length Human IKBKB Protein | +Inquiry |
IKBKB-28877TH | Recombinant Human IKBKB | +Inquiry |
IKBKB-125H | Recombinant Human IKBKB protein, GST-tagged | +Inquiry |
IKBKB-1065H | Recombinant Human IKBKB Protein (S695-S756), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKBKB-849HCL | Recombinant Human IKBKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
0
Inquiry Basket