Recombinant Full Length Human IL3 Protein, GST-tagged
| Cat.No. : | IL3-5760HF |
| Product Overview : | Human IL3 full-length ORF ( AAH69472.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 152 amino acids |
| Description : | The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ] |
| Official Symbol | IL3 |
| Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
| Gene ID | 3562 |
| mRNA Refseq | NM_000588 |
| Protein Refseq | NP_000579 |
| MIM | 147740 |
| UniProt ID | P08700 |
| ◆ Recombinant Proteins | ||
| IL3-1036H | Active Recombinant Human IL3 protein, His-tagged | +Inquiry |
| Il3-366M | Recombinant Mouse Il3 Protein, His-tagged | +Inquiry |
| IL3-2071R | Recombinant Rhesus Macaque IL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL3-187H | Recombinant Active Human IL3 Protein, His-tagged(C-ter) | +Inquiry |
| Il3-644M | Active Recombinant Mouse Il3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
| IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
