Recombinant Full Length Human IMPDH1 Protein, GST-tagged
Cat.No. : | IMPDH1-5865HF |
Product Overview : | Human IMPDH1 full-length ORF ( NP_899066.1, 1 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 563 amino acids |
Description : | The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 86.8 kDa |
AA Sequence : | MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IMPDH1 IMP (inosine 5-monophosphate) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | IMPDH1 |
Synonyms | IMPDH1; IMP (inosine 5-monophosphate) dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1 , retinitis pigmentosa 10 (autosomal dominant) , RP10; inosine-5-monophosphate dehydrogenase 1; LCA11; sWSS2608; IMPD 1; IMPDH 1; IMPDH-I; IMP dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1; IMPD; RP10; IMPD1; DKFZp781N0678; |
Gene ID | 3614 |
mRNA Refseq | NM_000883 |
Protein Refseq | NP_000874 |
MIM | 146690 |
UniProt ID | P20839 |
◆ Recombinant Proteins | ||
IMPDH1-8198M | Recombinant Mouse IMPDH1 Protein | +Inquiry |
IMPDH1-280H | Recombinant Human IMPDH1 protein, His-tagged | +Inquiry |
IMPDH1-5865HF | Recombinant Full Length Human IMPDH1 Protein, GST-tagged | +Inquiry |
Impdh1-3531M | Recombinant Mouse Impdh1 Protein, Myc/DDK-tagged | +Inquiry |
IMPDH1-2580H | Recombinant Human IMPDH1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPDH1-5211HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMPDH1 Products
Required fields are marked with *
My Review for All IMPDH1 Products
Required fields are marked with *
0
Inquiry Basket