Recombinant Full Length Human INSL5 Protein, GST-tagged

Cat.No. : INSL5-5987HF
Product Overview : Human INSL5 full-length ORF ( NP_005469, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 135 amino acids
Description : The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq
Molecular Mass : 40.48 kDa
AA Sequence : MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INSL5 insulin-like 5 [ Homo sapiens ]
Official Symbol INSL5
Synonyms INSL5; insulin-like 5; insulin-like peptide INSL5; insulin-like peptide 5; PRO182; UNQ156; MGC126695; MGC126697;
Gene ID 10022
mRNA Refseq NM_005478
Protein Refseq NP_005469
MIM 606413
UniProt ID Q9Y5Q6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSL5 Products

Required fields are marked with *

My Review for All INSL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon