Recombinant Full Length Human IRF6 Protein, C-Flag-tagged
Cat.No. : | IRF6-528HFL |
Product Overview : | Recombinant Full Length Human IRF6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS, Transcription Factors |
Full Length : | Full L. |
Gene Name | IRF6 interferon regulatory factor 6 [ Homo sapiens (human) ] |
Official Symbol | IRF6 |
Synonyms | LPS; PIT; PPS; VWS; OFC6; PPS1; VWS1 |
Gene ID | 3664 |
mRNA Refseq | NM_006147.4 |
Protein Refseq | NP_006138.1 |
MIM | 607199 |
UniProt ID | O14896 |
◆ Recombinant Proteins | ||
IRF6-10876Z | Recombinant Zebrafish IRF6 | +Inquiry |
IRF6-5741HF | Recombinant Full Length Human IRF6 Protein, GST-tagged | +Inquiry |
IRF6-2017H | Recombinant Human IRF6 protein, His & T7-tagged | +Inquiry |
IRF6-8304M | Recombinant Mouse IRF6 Protein | +Inquiry |
IRF6-2299R | Recombinant Rhesus monkey IRF6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF6-5161HCL | Recombinant Human IRF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF6 Products
Required fields are marked with *
My Review for All IRF6 Products
Required fields are marked with *
0
Inquiry Basket