Recombinant Full Length Human KLRA1P Protein, GST-tagged
Cat.No. : | KLRA1P-5877HF |
Product Overview : | Human KLRA1 full-length ORF ( AAH69734.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | KLRA1P (Killer Cell Lectin Like Receptor A1, Pseudogene) is a Pseudogene. Among its related pathways are Immune response Role of DAP12 receptors in NK cells. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLRA1P killer cell lectin like receptor A1, pseudogene [ Homo sapiens (human) ] |
Official Symbol | KLRA1P |
Synonyms | KLRA1P; killer cell lectin like receptor A1, pseudogene; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L; killer cell lectin-like receptor subfamily A pseudogene 1; killer cell lectin-like receptor subfamily A, member 1, pseudogene |
Gene ID | 10748 |
MIM | 604274 |
UniProt ID | Q7Z556 |
◆ Recombinant Proteins | ||
KLRA1P-4921H | Recombinant Human KLRA1P Protein, GST-tagged | +Inquiry |
KLRA1P-2202H | Recombinant Human KLRA1P Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLRA1P-686H | Recombinant Human KLRA1 Protein, MYC/DDK-tagged | +Inquiry |
KLRA1P-5877HF | Recombinant Full Length Human KLRA1P Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRA1P Products
Required fields are marked with *
My Review for All KLRA1P Products
Required fields are marked with *