Recombinant Human KLRA1P Protein, GST-tagged

• Cat.No.: KLRA1P-4921H
• Product Overview: Human KLRA1 full-length ORF ( AAH69734.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KLRA1P (Killer Cell Lectin Like Receptor A1, Pseudogene) is a Pseudogene. Among its related pathways are Immune response Role of DAP12 receptors in NK cells.
• Molecular Mass: 51.9 kDa
• AA Sequence: MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KLRA1P killer cell lectin like receptor A1, pseudogene [ Homo sapiens (human) ]
• Official Symbol: KLRA1P
• Synonyms: KLRA1P; killer cell lectin like receptor A1, pseudogene; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L; killer cell lectin-like receptor subfamily A pseudogene 1; killer cell lectin-like receptor subfamily A, member 1, pseudogene
• Gene ID: 10748
• MIM: 604274