Recombinant Human KLRA1P Protein, GST-tagged

Cat.No. : KLRA1P-4921H
Product Overview : Human KLRA1 full-length ORF ( AAH69734.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : KLRA1P (Killer Cell Lectin Like Receptor A1, Pseudogene) is a Pseudogene. Among its related pathways are Immune response Role of DAP12 receptors in NK cells.
Molecular Mass : 51.9 kDa
AA Sequence : MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLRA1P killer cell lectin like receptor A1, pseudogene [ Homo sapiens (human) ]
Official Symbol KLRA1P
Synonyms KLRA1P; killer cell lectin like receptor A1, pseudogene; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L; killer cell lectin-like receptor subfamily A pseudogene 1; killer cell lectin-like receptor subfamily A, member 1, pseudogene
Gene ID 10748
MIM 604274

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRA1P Products

Required fields are marked with *

My Review for All KLRA1P Products

Required fields are marked with *

0
cart-icon