Recombinant Human KLRA1P Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KLRA1P-2202H
• Product Overview: KLRA1 MS Standard C13 and N15-labeled recombinant protein (NP_006602) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: KLRA1P (Killer Cell Lectin Like Receptor A1, Pseudogene) is a Pseudogene. Among its related pathways are Immune response Role of DAP12 receptors in NK cells.
• Molecular Mass: 25.5 kDa
• AA Sequence: MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSMLDLRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KLRA1P killer cell lectin like receptor A1, pseudogene [ Homo sapiens (human) ]
• Official Symbol: KLRA1P
• Synonyms: KLRA1P; killer cell lectin like receptor A1, pseudogene; Ly49; KLRA1; LY49L; KLRAP1; Ly-49L; killer cell lectin-like receptor subfamily A pseudogene 1; killer cell lectin-like receptor subfamily A, member 1, pseudogene; MGC126520; MGC126522
• Gene ID: 10748
• mRNA Refseq: NM_006611
• Protein Refseq: NP_006602
• MIM: 604274