Recombinant Full Length Human LAIR2 Protein
Cat.No. : | LAIR2-273HF |
Product Overview : | Recombinant full length Human LAIR2 with N terminal proprietary tag; Predicted MW 42.79 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 42.790kDa inclusive of tags |
Protein Length : | 152 amino acids |
AA Sequence : | MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIS PGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVFRLGPS ESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | LAIR2 leukocyte-associated immunoglobulin-like receptor 2 [ Homo sapiens ] |
Official Symbol : | LAIR2 |
Synonyms : | LAIR2; leukocyte-associated immunoglobulin-like receptor 2; leukocyte associated Ig like receptor 2; CD306 |
Gene ID : | 3904 |
mRNA Refseq : | NM_002288 |
Protein Refseq : | NP_002279 |
MIM : | 602993 |
UniProt ID : | Q6ISS4 |
Products Types
◆ Recombinant Protein | ||
LAIR2-6973H | Recombinant Human LAIR2 protein(Met1-Pro152) | +Inquiry |
LAIR2-342H | Recombinant Human LAIR2 Protein, His-tagged | +Inquiry |
LAIR2-793H | Recombinant Human LAIR2 protein(Met1-Pro152), His-tagged | +Inquiry |
LAIR2-3326H | Recombinant Human LAIR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAIR2-051H | Active Recombinant Human LAIR2 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
◆ Lysates | ||
LAIR2-1774HCL | Recombinant Human LAIR2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket