Recombinant Full Length Human Leukosialin(Spn) Protein, His-Tagged
| Cat.No. : | RFL9493HF |
| Product Overview : | Recombinant Full Length Human Leukosialin(SPN) Protein (P16150) (20-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (20-400) |
| Form : | Lyophilized powder |
| AA Sequence : | STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SPN |
| Synonyms | CD 43; CD43; CD43 antigen; Galactoglycoprotein; GALGP; GPL 115; GPL115; Human gene for sialophorin ; Leucocyte sialoglycoprotein; LEUK_HUMAN; Leukocyte large sialoglycoprotein; Leukocyte sialoglycoprotein; Leukosialin; LSN; Ly-48; sialophorin (gpL115, leu |
| UniProt ID | P16150 |
| ◆ Recombinant Proteins | ||
| SPN-6532H | Recombinant Human SPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPN-6347H | Recombinant Human SPN Protein (Ser20-Arg253), His tagged | +Inquiry |
| Spn-7035MAF555 | Recombinant Mouse Spn Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| RFL26763MF | Recombinant Full Length Mouse Leukosialin(Spn) Protein, His-Tagged | +Inquiry |
| SPN-1439C | Recombinant Cynomolgus SPN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
| SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *



