Recombinant Full Length Human Leukosialin(Spn) Protein, His-Tagged
Cat.No. : | RFL9493HF |
Product Overview : | Recombinant Full Length Human Leukosialin(SPN) Protein (P16150) (20-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-400) |
Form : | Lyophilized powder |
AA Sequence : | STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPN |
Synonyms | CD 43; CD43; CD43 antigen; Galactoglycoprotein; GALGP; GPL 115; GPL115; Human gene for sialophorin ; Leucocyte sialoglycoprotein; LEUK_HUMAN; Leukocyte large sialoglycoprotein; Leukocyte sialoglycoprotein; Leukosialin; LSN; Ly-48; sialophorin (gpL115, leu |
UniProt ID | P16150 |
◆ Recombinant Proteins | ||
Spn-7035MP | Recombinant Mouse Spn protein, Fc-tagged, R-PE labeled | +Inquiry |
SPN-4264H | Recombinant Human Sialophorin | +Inquiry |
Spn-6102M | Recombinant Mouse Spn Protein, Myc/DDK-tagged | +Inquiry |
Spn-7035MF | Recombinant Mouse Spn Protein, Fc-tagged, FITC conjugated | +Inquiry |
Spn-7035M | Recombinant Mouse Spn protein(Met1-Gly248), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPN-893RCL | Recombinant Rat SPN cell lysate | +Inquiry |
SPN-1739MCL | Recombinant Mouse SPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPN Products
Required fields are marked with *
My Review for All SPN Products
Required fields are marked with *