Recombinant Full Length Human LGALS1 Protein, C-Flag-tagged
Cat.No. : | LGALS1-1706HFL |
Product Overview : | Recombinant Full Length Human LGALS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | LGALS1 galectin 1 [ Homo sapiens (human) ] |
Official Symbol | LGALS1 |
Synonyms | GBP; GAL1 |
Gene ID | 3956 |
mRNA Refseq | NM_002305.4 |
Protein Refseq | NP_002296.1 |
MIM | 150570 |
UniProt ID | P09382 |
◆ Recombinant Proteins | ||
Lgals1-1310M | Recombinant Mouse Lgals1 Protein, MYC/DDK-tagged | +Inquiry |
LGALS1-3143H | Recombinant Human LGALS1 Protein (Ala2-Asp135), C-His tagged | +Inquiry |
Lgals1-6744M | Recombinant Mouse Lgals1 protein, His&Myc-tagged | +Inquiry |
LGALS1-3163H | Recombinant Human LGALS1 protein, His-SUMO-tagged | +Inquiry |
Lgals1-4007M | Active Recombinant Mouse Lgals1 protein(Met1-Glu135) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS1-4770HCL | Recombinant Human LGALS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS1 Products
Required fields are marked with *
My Review for All LGALS1 Products
Required fields are marked with *
0
Inquiry Basket