Recombinant Full Length Human LIF Protein, C-Flag-tagged
Cat.No. : | LIF-1814HFL |
Product Overview : | Recombinant Full Length Human LIF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways : | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | LIF LIF interleukin 6 family cytokine [ Homo sapiens (human) ] |
Official Symbol | LIF |
Synonyms | CDF; DIA; HILDA; MLPLI |
Gene ID | 3976 |
mRNA Refseq | NM_002309.5 |
Protein Refseq | NP_002300.1 |
MIM | 159540 |
UniProt ID | P15018 |
◆ Recombinant Proteins | ||
LIF-1292H | Recombinant Human LIF Protein, His (Fc)-Avi-tagged | +Inquiry |
LIF-2031H | Active Recombinant Human LIF protein, His-tagged | +Inquiry |
LIF-30H | Active Recombinant Human LIF Protein (Carrier Free-Ready-to-Use, 181 amino acid) | +Inquiry |
LIF-101H | Active Recombinant Human LIF Protein | +Inquiry |
Lif-8869M | Active Recombinant Mouse LIF,His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *
0
Inquiry Basket