Recombinant Full Length Human LPAR4 Protein
Cat.No. : | LPAR4-5971HF |
Product Overview : | Human LPAR4 full-length ORF (NP_005287.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 424 amino acids |
Description : | This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | LPAR4 lysophosphatidic acid receptor 4 [ Homo sapiens ] |
Official Symbol | LPAR4 |
Synonyms | LPAR4; lysophosphatidic acid receptor 4; G protein coupled receptor 23 , GPR23; LPA4; P2RY9; P2Y5 LIKE; P2Y9; LPA-4; LPA receptor 4; P2Y purinoceptor 9; P2Y5-like receptor; purinergic receptor 9; G protein-coupled receptor 23; G-protein coupled receptor 23; GPR23; P2Y5-LIKE; |
Gene ID | 2846 |
mRNA Refseq | NM_005296 |
Protein Refseq | NP_005287 |
MIM | 300086 |
UniProt ID | Q99677 |
◆ Recombinant Proteins | ||
LPAR4-5971HF | Recombinant Full Length Human LPAR4 Protein | +Inquiry |
RFL17293MF | Recombinant Full Length Mouse Lysophosphatidic Acid Receptor 4(Lpar4) Protein, His-Tagged | +Inquiry |
LPAR4-9192M | Recombinant Mouse LPAR4 Protein | +Inquiry |
LPAR4-5330C | Recombinant Chicken LPAR4 | +Inquiry |
RFL26756HF | Recombinant Full Length Human Lysophosphatidic Acid Receptor 4(Lpar4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPAR4 Products
Required fields are marked with *
My Review for All LPAR4 Products
Required fields are marked with *
0
Inquiry Basket