Recombinant Full Length Human LTF Protein, C-Flag-tagged
Cat.No. : | LTF-1062HFL |
Product Overview : | Recombinant Full Length Human LTF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an important component of the non-specific immune system. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Antimicrobial, antiviral, antifungal and antiparasitic activity has been found for this protein and its peptides. Activity against both DNA and RNA viruses has been found, including activity against SARS-CoV-2, and HIV. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 76.1 kDa |
AA Sequence : | MKLVFLVLLFLGALGLCLAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIA ENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLR RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYF SYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSV NGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQN LRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVY TAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWN IPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCEPNSNERYYGYTGAFRCLAENAG DVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLK QVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTS PLLEACEFLRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Full Length : | Full L. |
Gene Name | LTF lactotransferrin [ Homo sapiens (human) ] |
Official Symbol | LTF |
Synonyms | LF; HLF2; GIG12; HEL110 |
Gene ID | 4057 |
mRNA Refseq | NM_002343.6 |
Protein Refseq | NP_002334.2 |
MIM | 150210 |
UniProt ID | P02788 |
◆ Recombinant Proteins | ||
LTF-1062HFL | Recombinant Full Length Human LTF Protein, C-Flag-tagged | +Inquiry |
LTF-3873H | Recombinant Human LTF, His tagged | +Inquiry |
Ltf-3864M | Recombinant Mouse Ltf Protein, Myc/DDK-tagged | +Inquiry |
LTF-7666H | Recombinant Human LTF protein, His-tagged | +Inquiry |
LTF-154H | Recombinant Human LTF protein | +Inquiry |
◆ Native Proteins | ||
LTF-27590TH | Native Human LTF | +Inquiry |
LTF-175H | Native Human lactoferrin | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTF-1585MCL | Recombinant Mouse LTF cell lysate | +Inquiry |
LTF-1859HCL | Recombinant Human LTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTF Products
Required fields are marked with *
My Review for All LTF Products
Required fields are marked with *
0
Inquiry Basket