Recombinant Full Length Human LY6E Protein, GST-tagged

Cat.No. : LY6E-6226HF
Product Overview : Human LY6E full-length ORF ( NP_002337.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 131 amino acids
Description : LY6E (Lymphocyte Antigen 6 Family Member E) is a Protein Coding gene. Diseases associated with LY6E include Leukemia, Acute Promyelocytic, Somatic. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins.
Molecular Mass : 39.9 kDa
AA Sequence : MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ]
Official Symbol LY6E
Synonyms LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; RIG E; SCA 2; TSA 1; ly-6E; stem cell antigen 2; thymic shared antigen 1; retinoic acid-induced gene E protein; RIGE; SCA2; RIG-E; SCA-2; TSA-1;
Gene ID 4061
mRNA Refseq NM_001127213
Protein Refseq NP_001120685
MIM 601384
UniProt ID Q16553

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LY6E Products

Required fields are marked with *

My Review for All LY6E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon