Recombinant Mouse Ly6e protein, His-B2M-tagged
Cat.No. : | Ly6e-4730M |
Product Overview : | Recombinant Mouse Ly6e protein(Q64253)(27-108 aa), fused with N-terminal His and B2M tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 27-108 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 22.8kDa |
AASequence : | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ] |
Official Symbol | Ly6e |
Synonyms | LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1; |
Gene ID | 17069 |
mRNA Refseq | NM_001164036 |
Protein Refseq | NP_001157508 |
◆ Recombinant Proteins | ||
LY6E-2407H | Recombinant Human LY6E Protein, His-tagged | +Inquiry |
Ly6e-4511M | Recombinant Mouse Ly6e protein, His&Myc-tagged | +Inquiry |
Ly6e-1754R | Recombinant Rat Ly6e Protein, His&GST-tagged | +Inquiry |
LY6E-2416R | Recombinant Rhesus Macaque LY6E Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6E-9368M | Recombinant Mouse LY6E Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ly6e Products
Required fields are marked with *
My Review for All Ly6e Products
Required fields are marked with *