Recombinant Mouse Ly6e protein, His-B2M-tagged

Cat.No. : Ly6e-4730M
Product Overview : Recombinant Mouse Ly6e protein(Q64253)(27-108 aa), fused with N-terminal His and B2M tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : B2M&His
Protein Length : 27-108 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 22.8kDa
AASequence : LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
Official Symbol Ly6e
Synonyms LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1;
Gene ID 17069
mRNA Refseq NM_001164036
Protein Refseq NP_001157508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ly6e Products

Required fields are marked with *

My Review for All Ly6e Products

Required fields are marked with *

0
cart-icon