Recombinant Mouse Ly6e protein, His-B2M-tagged

• Cat.No.: Ly6e-4730M
• Product Overview: Recombinant Mouse Ly6e protein(Q64253)(27-108 aa), fused with N-terminal His and B2M tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: B2M&His
• Protein Length: 27-108 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 22.8kDa
• AASequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
• Official Symbol: Ly6e
• Synonyms: LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1
• Gene ID: 17069
• mRNA Refseq: NM_001164036
• Protein Refseq: NP_001157508