Recombinant Mouse Ly6e protein, His-B2M-tagged
| Cat.No. : | Ly6e-4730M |
| Product Overview : | Recombinant Mouse Ly6e protein(Q64253)(27-108 aa), fused with N-terminal His and B2M tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 27-108 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 22.8kDa |
| AASequence : | LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ] |
| Official Symbol | Ly6e |
| Synonyms | LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1; |
| Gene ID | 17069 |
| mRNA Refseq | NM_001164036 |
| Protein Refseq | NP_001157508 |
| ◆ Recombinant Proteins | ||
| LY6E-6226HF | Recombinant Full Length Human LY6E Protein, GST-tagged | +Inquiry |
| Ly6e-1754R | Recombinant Rat Ly6e Protein, His&GST-tagged | +Inquiry |
| LY6E-4570H | Recombinant Human LY6E Protein, GST-tagged | +Inquiry |
| LY6E-1743M | Recombinant Mouse LY6E Protein (21-102 aa), His-SUMO-tagged | +Inquiry |
| LY6E-6339C | Recombinant Chicken LY6E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6E-4601HCL | Recombinant Human LY6E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ly6e Products
Required fields are marked with *
My Review for All Ly6e Products
Required fields are marked with *



