Recombinant Full Length Human LY6G5B Protein, GST-tagged
Cat.No. : | LY6G5B-6227HF |
Product Overview : | Human LY6G5B full-length ORF ( NP_067044.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM |
Molecular Mass : | 49 kDa |
AA Sequence : | MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LY6G5B lymphocyte antigen 6 complex, locus G5B [ Homo sapiens ] |
Official Symbol | LY6G5B |
Synonyms | LY6G5B; lymphocyte antigen 6 complex, locus G5B; C6orf19, chromosome 6 open reading frame 19; lymphocyte antigen 6 complex locus protein G5b; G5b; lymphocyte antigen-6 G5B; C6orf19; |
Gene ID | 58496 |
mRNA Refseq | NM_021221 |
Protein Refseq | NP_067044 |
MIM | 610433 |
UniProt ID | Q8NDX9 |
◆ Recombinant Proteins | ||
LY6G5B-6227HF | Recombinant Full Length Human LY6G5B Protein, GST-tagged | +Inquiry |
LY6G5B-3508R | Recombinant Rat LY6G5B Protein | +Inquiry |
LY6G5B-4569H | Recombinant Human LY6G5B Protein, GST-tagged | +Inquiry |
LY6G5B-9370M | Recombinant Mouse LY6G5B Protein | +Inquiry |
LY6G5B-5253M | Recombinant Mouse LY6G5B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LY6G5B-1039HCL | Recombinant Human LY6G5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LY6G5B Products
Required fields are marked with *
My Review for All LY6G5B Products
Required fields are marked with *
0
Inquiry Basket