Recombinant Human LY6G5B Protein, GST-tagged

Cat.No. : LY6G5B-4569H
Product Overview : Human LY6G5B full-length ORF ( NP_067044.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM
Molecular Mass : 49 kDa
AA Sequence : MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LY6G5B lymphocyte antigen 6 complex, locus G5B [ Homo sapiens ]
Official Symbol LY6G5B
Synonyms LY6G5B; lymphocyte antigen 6 complex, locus G5B; C6orf19, chromosome 6 open reading frame 19; lymphocyte antigen 6 complex locus protein G5b; G5b; lymphocyte antigen-6 G5B; C6orf19;
Gene ID 58496
mRNA Refseq NM_021221
Protein Refseq NP_067044
MIM 610433
UniProt ID Q8NDX9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6G5B Products

Required fields are marked with *

My Review for All LY6G5B Products

Required fields are marked with *

0
cart-icon
0
compare icon