Recombinant Human LYZL1, His-tagged
| Cat.No. : | LYZL1-133H |
| Product Overview : | Recombinant Human Lysozyme-Like Protein 1/LYZL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys20-Ser148) of Human LYZL1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 20-148 a.a. |
| Description : | Lysozyme-Like Protein 1 (LYZL1) is a member of the glycosyl hydrolase 22 family. Lysozymes are a family of enzymes that damage bacterial cell walls by catalyzing hydrolysis of 1,4-β-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence and structure making them part of the same family. LYZL1 is a secreted protein and exists as a monomer. |
| AA Sequence : | KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCR RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVSV DHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | LYZL1 lysozyme-like 1 [ Homo sapiens ] |
| Official Symbol | LYZL1 |
| Synonyms | LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1; |
| Gene ID | 84569 |
| mRNA Refseq | NM_032517 |
| Protein Refseq | NP_115906 |
| UniProt ID | Q6UWQ5 |
| Chromosome Location | 10p12.1 |
| Function | hydrolase activity, acting on glycosyl bonds; lysozyme activity; |
| ◆ Recombinant Proteins | ||
| LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYZL1-4531H | Recombinant Human LYZL1 Protein, GST-tagged | +Inquiry |
| LYZL1-6039HF | Recombinant Full Length Human LYZL1 Protein, GST-tagged | +Inquiry |
| LYZL1-1042H | Recombinant Human LYZL1 Protein (1-194 aa), His-SUMO-tagged | +Inquiry |
| LYZL1-9412M | Recombinant Mouse LYZL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL1 Products
Required fields are marked with *
My Review for All LYZL1 Products
Required fields are marked with *
