Recombinant Human LYZL1, His-tagged

Cat.No. : LYZL1-133H
Product Overview : Recombinant Human Lysozyme-Like Protein 1/LYZL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys20-Ser148) of Human LYZL1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-148 a.a.
Description : Lysozyme-Like Protein 1 (LYZL1) is a member of the glycosyl hydrolase 22 family. Lysozymes are a family of enzymes that damage bacterial cell walls by catalyzing hydrolysis of 1,4-β-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence and structure making them part of the same family. LYZL1 is a secreted protein and exists as a monomer.
AA Sequence : KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCR RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVSV DHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name LYZL1 lysozyme-like 1 [ Homo sapiens ]
Official Symbol LYZL1
Synonyms LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1;
Gene ID 84569
mRNA Refseq NM_032517
Protein Refseq NP_115906
UniProt ID Q6UWQ5
Chromosome Location 10p12.1
Function hydrolase activity, acting on glycosyl bonds; lysozyme activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYZL1 Products

Required fields are marked with *

My Review for All LYZL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon