Recombinant Human LYZL1, His-tagged
Cat.No. : | LYZL1-133H |
Product Overview : | Recombinant Human Lysozyme-Like Protein 1/LYZL1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys20-Ser148) of Human LYZL1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-148 a.a. |
Description : | Lysozyme-Like Protein 1 (LYZL1) is a member of the glycosyl hydrolase 22 family. Lysozymes are a family of enzymes that damage bacterial cell walls by catalyzing hydrolysis of 1,4-β-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Large amounts of lysozyme can be found in egg white. C-type lysozymes are closely related to alpha-lactalbumin in sequence and structure making them part of the same family. LYZL1 is a secreted protein and exists as a monomer. |
AA Sequence : | KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCR RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVSV DHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | LYZL1 lysozyme-like 1 [ Homo sapiens ] |
Official Symbol | LYZL1 |
Synonyms | LYZL1; lysozyme-like 1; lysozyme-like protein 1; LYC2; MGC33408; KAAG648; PRO1278; bA534G20.1; |
Gene ID | 84569 |
mRNA Refseq | NM_032517 |
Protein Refseq | NP_115906 |
UniProt ID | Q6UWQ5 |
Chromosome Location | 10p12.1 |
Function | hydrolase activity, acting on glycosyl bonds; lysozyme activity; |
◆ Recombinant Proteins | ||
LYZL1-5280M | Recombinant Mouse LYZL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL1-4531H | Recombinant Human LYZL1 Protein, GST-tagged | +Inquiry |
LYZL1-133H | Recombinant Human LYZL1, His-tagged | +Inquiry |
LYZL1-6039HF | Recombinant Full Length Human LYZL1 Protein, GST-tagged | +Inquiry |
LYZL1-9412M | Recombinant Mouse LYZL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL1-4579HCL | Recombinant Human LYZL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYZL1 Products
Required fields are marked with *
My Review for All LYZL1 Products
Required fields are marked with *
0
Inquiry Basket