Recombinant Full Length Human MALSU1 Protein, GST-tagged

Cat.No. : MALSU1-3834HF
Product Overview : Human C7orf30 full-length ORF ( NP_612455.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 234 amino acids
Description : MALSU1 (Mitochondrial Assembly Of Ribosomal Large Subunit 1) is a Protein Coding gene. GO annotations related to this gene include ribosomal large subunit binding.
Molecular Mass : 52.6 kDa
AA Sequence : MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MALSU1 mitochondrial assembly of ribosomal large subunit 1 [ Homo sapiens (human) ]
Official Symbol MALSU1
Synonyms C7orf30; MALSU1; mitochondrial assembly of ribosomal large subunit 1; mtRsfA; mitochondrial assembly of ribosomal large subunit protein 1
Gene ID 115416
mRNA Refseq NM_138446
Protein Refseq NP_612455
MIM 614624
UniProt ID Q96EH3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MALSU1 Products

Required fields are marked with *

My Review for All MALSU1 Products

Required fields are marked with *

0
cart-icon
0
compare icon